Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chromobacterium violaceum ATP synthase subunit a (atpB)

This Recombinant Chromobacterium violaceum ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7P0A1

Expression Region

1-270

Origin

Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASNATDYIKHHLTFWNSDPSAGFWSLHVDTFSISLVLGFLFAAVFAMVARRASIEAPGR LQLFVEMIVELVQTQVREVFHGKSKMIAPLALTIFCWVFLMNFMDLFPVDLFPMAAQWIG YTFFGLEPHHVYFRVVPSADVNATFAMSLSVLILIVGFSIKAKGLGGWGKELLTAPFHSS NPVGAIILAPLNFAFQLVELAAKPISLSLRLFGNLYAGELIFILIALLPWGLQWVLGAPW AIFHILIITLQAFVFMMLTIVYLSLAVEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Mucin 1 (MUC1)
TRV-0038071-01 24 Tests

ELISA Kit for Mucin 1 (MUC1)

Sign In for Pricing
View Details
ELISA Kit for Mucin 1 (MUC1)
TRV-0038071-02 48 Tests

ELISA Kit for Mucin 1 (MUC1)

Sign In for Pricing
View Details
ELISA Kit for Mucin 1 (MUC1)
TRV-0038071-03 96 Tests

ELISA Kit for Mucin 1 (MUC1)

Sign In for Pricing
View Details
ELISA Kit for Mucin 1 (MUC1)
TRV-0038071-04 5x 96 Tests

ELISA Kit for Mucin 1 (MUC1)

Sign In for Pricing
View Details
ELISA Kit for Mucin 1 (MUC1)
TRV-0038071-05 10x 96 Tests

ELISA Kit for Mucin 1 (MUC1)

Sign In for Pricing
View Details
HOXB3 Protein Vector (Mouse) (pPM-C-HA)
23819025 500 ng

HOXB3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details