Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Monocyte to macrophage differentiation factor 2 (MMD2)

This Recombinant Human Monocyte to macrophage differentiation factor 2 (MMD2) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Monocyte to macrophage differentiation factor 2, Progestin and adipoQ receptor family member 10, Progestin and adipoQ receptor family member X

UniProt

Q8IY49

Expression Region

1-270

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSILGSSNLYFLS DDDWETISAWIYGLGLCGLFVVSTVFHTISWKKSHLRMVEHCLHMFDRMVIYFFIAASYA PWLNLRELGPWASHMRWLVWIMASVGTIYVFFFHERTGSCVQFLRGEACPKAGTACLPAR YKLVELLCYVVMGFFPALVILSMPNTEGIWELVTGGVFYCLGMVFFKSDGRIPFAHAIWH LFVAFGAGTHYYAIWRYLYLPSTLQTKVSK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Goose IgY (H&L) - TRITC
MBS8327759-01 0.1 mL

Rabbit Anti-Goose IgY (H&L) - TRITC

Sign In for Pricing
View Details
Rabbit Anti-Goose IgY (H&L) - TRITC
MBS8327759-02 0.5 mL

Rabbit Anti-Goose IgY (H&L) - TRITC

Sign In for Pricing
View Details
Rabbit Anti-Goose IgY (H&L) - TRITC
MBS8327759-03 1 mL

Rabbit Anti-Goose IgY (H&L) - TRITC

Sign In for Pricing
View Details
Rabbit Anti-Goose IgY (H&L) - TRITC
MBS8327759-04 5x 1 mL

Rabbit Anti-Goose IgY (H&L) - TRITC

Sign In for Pricing
View Details
Claudin 14 (CLDN14) (NM_001146078) Human 3' UTR Clone
SC204993 10 µg

Claudin 14 (CLDN14) (NM_001146078) Human 3' UTR Clone

Sign In for Pricing
View Details
SPCS3 (HRP) discontinued
577599-01 50 µg

SPCS3 (HRP) discontinued

Sign In for Pricing
View Details