Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

P48873

Expression Region

1-270

Origin

Cyanidium caldarium

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMSLIVKDLQRYPFHLVDPSPWPFVASFSALIILLGGVLYFHTYQGSLVILFFGIFFLLL IIFVWWRDVVRESTFEGNHTTMVQLGMRYGIMLFIFSEVILFIAFFWAFFHNSLIPALET GVVWPPKGIQFFSPWDIPFLNTIILLLSGCAVTWSHNCIISGFRRQAIFSLILTIGLALI FTIFQIYEYAIASFHLSDGAYGSTFFMITGLHGFHVIVGTFFLFVCMFRLVQYHFTMQHH YGFEAATWYWHFVDVVWLFLFVSIYWWGSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTDC1 Antibody - N-terminal region : FITC (ARP48906_P050-FITC)
ARP48906_P050-FITC 100 µL

GTDC1 Antibody - N-terminal region : FITC (ARP48906_P050-FITC)

Sign In for Pricing
View Details
ADD2 Rabbit pAb
E2821519 100 µL

ADD2 Rabbit pAb

Sign In for Pricing
View Details
FAM152A shRNA Plasmid (m)
sc-140404-SH 20 µg

FAM152A shRNA Plasmid (m)

Sign In for Pricing
View Details
GJA1 Rabbit Polyclonal Antibody (Biotin)
orb2131628 100 µL

GJA1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CIB3 Antibody
orb1313748-01 30 µL

CIB3 Antibody

Sign In for Pricing
View Details
CIB3 Antibody
orb1313748-02 50 μL

CIB3 Antibody

Sign In for Pricing
View Details