Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

P48873

Expression Region

1-270

Origin

Cyanidium caldarium

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMSLIVKDLQRYPFHLVDPSPWPFVASFSALIILLGGVLYFHTYQGSLVILFFGIFFLLL IIFVWWRDVVRESTFEGNHTTMVQLGMRYGIMLFIFSEVILFIAFFWAFFHNSLIPALET GVVWPPKGIQFFSPWDIPFLNTIILLLSGCAVTWSHNCIISGFRRQAIFSLILTIGLALI FTIFQIYEYAIASFHLSDGAYGSTFFMITGLHGFHVIVGTFFLFVCMFRLVQYHFTMQHH YGFEAATWYWHFVDVVWLFLFVSIYWWGSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLGA nanoparticles (500nm)
orb3026600-01 200 mg

PLGA nanoparticles (500nm)

Sign In for Pricing
View Details
PLGA nanoparticles (500nm)
orb3026600-02 100 mg

PLGA nanoparticles (500nm)

Sign In for Pricing
View Details
PLGA nanoparticles (500nm)
orb3026600-03 50 mg

PLGA nanoparticles (500nm)

Sign In for Pricing
View Details
Rabbit Polyclonal SLC1A5 Antibody
NBP2-32238 100 µL

Rabbit Polyclonal SLC1A5 Antibody

Sign In for Pricing
View Details
CD22 Mouse Monoclonal Antibody [Clone 1F12]
E45M13836V-2 50 µL

CD22 Mouse Monoclonal Antibody [Clone 1F12]

Sign In for Pricing
View Details
ZNF207 Antibody, FITC conjugated
A38784-100UG 100 µg

ZNF207 Antibody, FITC conjugated

Sign In for Pricing
View Details