Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcoides burtonii Cobalamin synthase (cobS)

This Recombinant Methanococcoides burtonii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-271.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q12UB0

Expression Region

1-271

Origin

Methanococcoides burtonii (strain DSM 6242)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGFLLALRTTFGFLSTIPVGMSMEGLDELVKRSYLQTFAGIVLGSMIGIFAYLTESFLP STISAVLIMVFIYYITGLNHLDGLGDFGDGATAHGSLEKKVNALKDMSLGIGGVSYTVLA LIALYASISSLQAEVLFFSDNAALIIAISLLIAEIGAKQAMLTVAAFGKPIHEGLGSMII NNTTFPRYAVSFVLGALVCVLAFGTLGIIGYISAIVTAFVILNISIRHFKGINGDCIGTS NEIARIIVLMVLTVAITAVNNGYGGLFWTPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDN2 Polyclonal Antibody
MBS8531502-01 0.1 mg

EDN2 Polyclonal Antibody

Sign In for Pricing
View Details
EDN2 Polyclonal Antibody
MBS8531502-02 0.1 mL (AF635)

EDN2 Polyclonal Antibody

Sign In for Pricing
View Details
EDN2 Polyclonal Antibody
MBS8531502-03 0.1 mL (AF610)

EDN2 Polyclonal Antibody

Sign In for Pricing
View Details
EDN2 Polyclonal Antibody
MBS8531502-04 0.1 mL (AF405S)

EDN2 Polyclonal Antibody

Sign In for Pricing
View Details
EDN2 Polyclonal Antibody
MBS8531502-05 0.1 mL (AF405L)

EDN2 Polyclonal Antibody

Sign In for Pricing
View Details
EDN2 Polyclonal Antibody
MBS8531502-06 0.1 mL (AF546)

EDN2 Polyclonal Antibody

Sign In for Pricing
View Details