Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter lovleyi Undecaprenyl-diphosphatase (uppP)

This Recombinant Geobacter lovleyi Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B3E340

Expression Region

1-272

Origin

Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLLHAALLGLIQGATEVLPISSSGHLILIPRLLGWPDSGLTFDVALHFGTFLAIFVYFR KDVVSLVQDGLTGFFQPEAPRRLRLPWMIVLASIPAAIAGKTLEQPIEELFRSSPLMIAL MLILFGLGLGLTDRYGKKLHDVASITLGTAMLVGCFQCLALVPGVSRSGITITAGLLLGL ARTDAARFSFLLSLPIVFGAALLKGLHLLKHGIEPGMAMPMLVGVAVSAVVGYISVAFLL KFVQSRTLWPFVWYRVAAGIGVMALLGVGLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-500 1x 500 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-500 1x 500 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF594 conjugate, 0.1mg/mL
BNC940902-100 1x 100 µL

Nucleolin (NCL/902), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/782 + BCL2/796), CF740 conjugate, 0.1mg/mL
BNC741023-100 1x 100 µL

Bcl-2 (BCL2/782 + BCL2/796), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLG1 (Golgi Complex) (GLG1/970), CF594 conjugate, 0.1mg/mL
BNC940970-500 1x 500 µL

GLG1 (Golgi Complex) (GLG1/970), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF594 conjugate, 0.1mg/mL
BNC942904-100 1x 100 µL

WIPI2 (2A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details