Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Acinetobacter baumannii Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

B0VL66

Expression Region

1-272

Origin

Acinetobacter baumannii (strain SDF)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTYPNIDPVAIHLGPLQVHWYGLMYLLAFLCAWGLASYRTKQRDGWTSDMVSDLVFYGA LGVVLGGRIGYVLFYEFDKFLENPIWLFQVWTGGMSFHGGFLGVMIAMLFWCKKYQKTWF QTLDFIAPCVPTGLMLGRIGNFIGGELYGRAVTDPNYPFGMIFPTDPLHLVRHPSQIYQA LCEGLLLFIILWWFSSKPRPRMAVSALFLMGYGVARFVMEFFRQPDADQGFILFGWMTKG QILTVPMLLIGLWMMWYAYQKKIYDWGPQKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ABCC2 Pre-designed siRNA Set B
SI000056B 1 Each

Human ABCC2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Avatrombopag Impurity 24
RM-A220124-01 10 mg

Avatrombopag Impurity 24

Sign In for Pricing
View Details
Avatrombopag Impurity 24
RM-A220124-02 25 mg

Avatrombopag Impurity 24

Sign In for Pricing
View Details
Avatrombopag Impurity 24
RM-A220124-03 50 mg

Avatrombopag Impurity 24

Sign In for Pricing
View Details
Avatrombopag Impurity 24
RM-A220124-04 100 mg

Avatrombopag Impurity 24

Sign In for Pricing
View Details
Zfp652 (NM_201609) Mouse Tagged ORF Clone Lentiviral Particle
MR215596L3V 200 µL

Zfp652 (NM_201609) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details