Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Acinetobacter baumannii Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

B0V4R4

Expression Region

1-272

Origin

Acinetobacter baumannii (strain AYE)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTYPNIDPVAIHLGPLQVHWYGLMYLLAFLCAWGLASYRAKQRDGWTSDMVSDLVFYGA LGVVLGGRIGYVLFYEFDKFLENPIWLFQVWTGGMSFHGGFLGVMIAMLFWCKKYQKTWF QTLDFVAPCVPTGLMFGRIGNFIGGELYGRAVTDPNYPFGMIFPTDPLHLVRHPSQIYQA LCEGLLLFIILWWFSSKPRPRMAVSALFLMGYGVARFVMEFFRQPDADQGFILFGWMTKG QILTVPMLLIGLWMMWYAYQKKIYDWGPQKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSTA (SLC51A) Human Gene Knockout Kit (CRISPR)
KN419313 1 Kit

OSTA (SLC51A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Propenylfuran
TRC-P835190-500MG 500 mg

2-Propenylfuran

Sign In for Pricing
View Details
Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit
E-CL-M0236-01 24 Tests

Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit

Sign In for Pricing
View Details
Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit
E-CL-M0236-02 48 Tests

Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit

Sign In for Pricing
View Details
Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit
E-CL-M0236-03 96 Tests

Mouse CTXI (Cross Linked C-telopeptide of Type I Collagen) CLIA Kit

Sign In for Pricing
View Details
CNOT7 Human Gene Knockout Kit (CRISPR)
KN209293RB 1 Kit

CNOT7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details