Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Acinetobacter baumannii Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

B0V4R4

Expression Region

1-272

Origin

Acinetobacter baumannii (strain AYE)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTYPNIDPVAIHLGPLQVHWYGLMYLLAFLCAWGLASYRAKQRDGWTSDMVSDLVFYGA LGVVLGGRIGYVLFYEFDKFLENPIWLFQVWTGGMSFHGGFLGVMIAMLFWCKKYQKTWF QTLDFVAPCVPTGLMFGRIGNFIGGELYGRAVTDPNYPFGMIFPTDPLHLVRHPSQIYQA LCEGLLLFIILWWFSSKPRPRMAVSALFLMGYGVARFVMEFFRQPDADQGFILFGWMTKG QILTVPMLLIGLWMMWYAYQKKIYDWGPQKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/3802), Biotin conjugate, 0.1mg/mL
BNCB3802-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/3802), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMED1 Human Gene Knockout Kit (CRISPR)
KN400255 1 Kit

TMED1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Phenoxy-2-propanol
TRC-P301700-250G 250 g

1-Phenoxy-2-propanol

Sign In for Pricing
View Details
CD66 (CEA) (COL-1 + CEA31 + C66/261), CF405S conjugate, 0.1mg/mL
BNC040747-500 1x 500 µL

CD66 (CEA) (COL-1 + CEA31 + C66/261), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Herpes Virus Type 8 / HHV8 ORF57 Rabbit Polyclonal Antibody
AP09401PU-S 25 µL

Herpes Virus Type 8 / HHV8 ORF57 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF740 conjugate, 0.1mg/mL
BNC742096-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details