Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Acinetobacter baumannii Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

B0V4R4

Expression Region

1-272

Origin

Acinetobacter baumannii (strain AYE)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTYPNIDPVAIHLGPLQVHWYGLMYLLAFLCAWGLASYRAKQRDGWTSDMVSDLVFYGA LGVVLGGRIGYVLFYEFDKFLENPIWLFQVWTGGMSFHGGFLGVMIAMLFWCKKYQKTWF QTLDFVAPCVPTGLMFGRIGNFIGGELYGRAVTDPNYPFGMIFPTDPLHLVRHPSQIYQA LCEGLLLFIILWWFSSKPRPRMAVSALFLMGYGVARFVMEFFRQPDADQGFILFGWMTKG QILTVPMLLIGLWMMWYAYQKKIYDWGPQKNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD209b (22D1) In Vivo Antibody - Low Endotoxin
ICH1077-25mg 25 mg

Anti-Mouse CD209b (22D1) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Mouse Aanat activation kit by CRISPRa
GA200002 1 Kit

Mouse Aanat activation kit by CRISPRa

Sign In for Pricing
View Details
Human alpha Fetoprotein Recombinant Rabbit monoclonal Antibody
HA723648B 100 µL

Human alpha Fetoprotein Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cefteram Pivoxil
TRC-C244300-25MG 25 mg

Cefteram Pivoxil

Sign In for Pricing
View Details
Human ATCAY activation kit by CRISPRa
GA113844 1 Kit

Human ATCAY activation kit by CRISPRa

Sign In for Pricing
View Details
KPNA6 (NM_012316) Human Over-expression Lysate
LC402193 20 µg

KPNA6 (NM_012316) Human Over-expression Lysate

Sign In for Pricing
View Details