Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubrobacter xylanophilus Undecaprenyl-diphosphatase (uppP)

This Recombinant Rubrobacter xylanophilus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q1AWM0

Expression Region

1-272

Origin

Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLELLQAVLLGAVQGLTEFLPVSSSGHLLLGQYFLGLDQDRFGLSFDVALHLGTLVAVVV FFRRDLLRMAGAFVRSLTRGRDLSEPDQRLAYLVLAATVPAALIGYLWEDFFETAVRSPW VVVFNLAFVGLLFLVAEAVGRKSRRAEKMGFAEAVGIGLAQAAALVPGVSRSGATITLGL LFGLRREEAARFSFLMSAPIIAGAGTLQLGEVLAEGMGAEQALMFAVGFLCSAVVGYLAI RFFISFVARYSLRAFAYYRFALAALVAALLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-4-chloro-L-b-homophenylalanine 98+% (HPLC)
238089-01 100 mg

Fmoc-4-chloro-L-b-homophenylalanine 98+% (HPLC)

Sign In for Pricing
View Details
Fmoc-4-chloro-L-b-homophenylalanine 98+% (HPLC)
238089-02 250 mg

Fmoc-4-chloro-L-b-homophenylalanine 98+% (HPLC)

Sign In for Pricing
View Details
Fmoc-4-chloro-L-b-homophenylalanine 98+% (HPLC)
238089-03 1 g

Fmoc-4-chloro-L-b-homophenylalanine 98+% (HPLC)

Sign In for Pricing
View Details
Fmoc-4-chloro-L-b-homophenylalanine 98+% (HPLC)
238089-04 5 g

Fmoc-4-chloro-L-b-homophenylalanine 98+% (HPLC)

Sign In for Pricing
View Details
Lentiviral mouse Gckr shRNA (UAS) - Lentiviral mouse Gckr shRNA (UAS, RFP) (25)
GTR15287519 1 Vial

Lentiviral mouse Gckr shRNA (UAS) - Lentiviral mouse Gckr shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Sodium Lauryl Sulfoacetate
S3801-25mg 25 mg

Sodium Lauryl Sulfoacetate

Sign In for Pricing
View Details