Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rubrobacter xylanophilus Undecaprenyl-diphosphatase (uppP)

This Recombinant Rubrobacter xylanophilus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q1AWM0

Expression Region

1-272

Origin

Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLELLQAVLLGAVQGLTEFLPVSSSGHLLLGQYFLGLDQDRFGLSFDVALHLGTLVAVVV FFRRDLLRMAGAFVRSLTRGRDLSEPDQRLAYLVLAATVPAALIGYLWEDFFETAVRSPW VVVFNLAFVGLLFLVAEAVGRKSRRAEKMGFAEAVGIGLAQAAALVPGVSRSGATITLGL LFGLRREEAARFSFLMSAPIIAGAGTLQLGEVLAEGMGAEQALMFAVGFLCSAVVGYLAI RFFISFVARYSLRAFAYYRFALAALVAALLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat C-C chemokine receptor type 3 ELISA Kit
orb1659150 96 Tests

Rat C-C chemokine receptor type 3 ELISA Kit

Sign In for Pricing
View Details
PTGER3 Rabbit Polyclonal Antibody (Fluoro647)
orb3110310 100 µg

PTGER3 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Cefcapene Pivoxil Impurity 38
RM-C031638-01 10 mg

Cefcapene Pivoxil Impurity 38

Sign In for Pricing
View Details
Cefcapene Pivoxil Impurity 38
RM-C031638-02 25 mg

Cefcapene Pivoxil Impurity 38

Sign In for Pricing
View Details
Cefcapene Pivoxil Impurity 38
RM-C031638-03 50 mg

Cefcapene Pivoxil Impurity 38

Sign In for Pricing
View Details
Cefcapene Pivoxil Impurity 38
RM-C031638-04 100 mg

Cefcapene Pivoxil Impurity 38

Sign In for Pricing
View Details