Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q37600

Expression Region

1-272

Origin

Pylaiella littoralis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSTAKMIQRHPFHLVDPSPWPLVAALGGLSLTFGGVLFMHNYEGGGELLCLGFFTILYV MFTWWRDVIREALFEGQHTLAVQQGLRMGMILFIVSEIMFFFAFFWAFFTSSISPVFNIG GVWPPTDVVAISPWGLPFLNTILLLSSGASVTWAHHAIVGGLKKEAMQGLSVTLAFAIAF TAMQGFEYSGAPFGMSDGVYGSVFYMATGFHGFHVIIGTIFLFICTIRLYLSHFSCQHHF GFEAAAWYWHFVDVVWLFLFLTIYWWGFNITV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reagecon Refractive Index Standard (Solvent Based) 1.51726 nD units at 20°C
RI0151 15 mL

Reagecon Refractive Index Standard (Solvent Based) 1.51726 nD units at 20°C

Sign In for Pricing
View Details
Monkey C-Type Natriuretic Peptide ELISA Kit
MBS739154-01 48 Well

Monkey C-Type Natriuretic Peptide ELISA Kit

Sign In for Pricing
View Details
Monkey C-Type Natriuretic Peptide ELISA Kit
MBS739154-02 96 Well

Monkey C-Type Natriuretic Peptide ELISA Kit

Sign In for Pricing
View Details
Monkey C-Type Natriuretic Peptide ELISA Kit
MBS739154-03 5x 96 Well

Monkey C-Type Natriuretic Peptide ELISA Kit

Sign In for Pricing
View Details
Monkey C-Type Natriuretic Peptide ELISA Kit
MBS739154-04 10x 96 Well

Monkey C-Type Natriuretic Peptide ELISA Kit

Sign In for Pricing
View Details
5-Methoxy-3,3-dimethylisoindolin-1-one
JHA90629-01 50 mg

5-Methoxy-3,3-dimethylisoindolin-1-one

Sign In for Pricing
View Details