Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q37600

Expression Region

1-272

Origin

Pylaiella littoralis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSTAKMIQRHPFHLVDPSPWPLVAALGGLSLTFGGVLFMHNYEGGGELLCLGFFTILYV MFTWWRDVIREALFEGQHTLAVQQGLRMGMILFIVSEIMFFFAFFWAFFTSSISPVFNIG GVWPPTDVVAISPWGLPFLNTILLLSSGASVTWAHHAIVGGLKKEAMQGLSVTLAFAIAF TAMQGFEYSGAPFGMSDGVYGSVFYMATGFHGFHVIIGTIFLFICTIRLYLSHFSCQHHF GFEAAAWYWHFVDVVWLFLFLTIYWWGFNITV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hmx3 Pre-designed siRNA Set B
SI106250B 1 Each

Mouse Hmx3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TBXA2R Protein Vector (Human) (pPM-C-His)
PV134985 500 ng

TBXA2R Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CPXCR1 Blocking Peptide
MBS9622666-01 1 mg

CPXCR1 Blocking Peptide

Sign In for Pricing
View Details
CPXCR1 Blocking Peptide
MBS9622666-02 5x 1 mg

CPXCR1 Blocking Peptide

Sign In for Pricing
View Details
4-Ethoxy-2- (methylthio) pyrimidine-5-carboxylic acid
OR1032345-01 100 mg

4-Ethoxy-2- (methylthio) pyrimidine-5-carboxylic acid

Sign In for Pricing
View Details
4-Ethoxy-2- (methylthio) pyrimidine-5-carboxylic acid
OR1032345-02 250 mg

4-Ethoxy-2- (methylthio) pyrimidine-5-carboxylic acid

Sign In for Pricing
View Details