Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q37600

Expression Region

1-272

Origin

Pylaiella littoralis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSTAKMIQRHPFHLVDPSPWPLVAALGGLSLTFGGVLFMHNYEGGGELLCLGFFTILYV MFTWWRDVIREALFEGQHTLAVQQGLRMGMILFIVSEIMFFFAFFWAFFTSSISPVFNIG GVWPPTDVVAISPWGLPFLNTILLLSSGASVTWAHHAIVGGLKKEAMQGLSVTLAFAIAF TAMQGFEYSGAPFGMSDGVYGSVFYMATGFHGFHVIIGTIFLFICTIRLYLSHFSCQHHF GFEAAAWYWHFVDVVWLFLFLTIYWWGFNITV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCK8 Rabbit Polyclonal Antibody (BF647)
orb2556476 100 µL

CCK8 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Cryo.s, U, skirt, 2ml, polypropylene, graduation, writing area, neutral screw cap, 150 inserts, subpacked per 100 pieces, 2D code, barcode, off the shelf sequence, STERILE, 500 pieces per CAR
122263-2DG 500 pieces per CAR

Cryo.s, U, skirt, 2ml, polypropylene, graduation, writing area, neutral screw cap, 150 inserts, subpacked per 100 pieces, 2D code, barcode, off the shelf sequence, STERILE, 500 pieces per CAR

Sign In for Pricing
View Details
Kir6.1 Rabbit Polyclonal Antibody
orb667057-01 30 µL

Kir6.1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kir6.1 Rabbit Polyclonal Antibody
orb667057-02 50 μL

Kir6.1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kir6.1 Rabbit Polyclonal Antibody
orb667057-03 100 µL

Kir6.1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kir6.1 Rabbit Polyclonal Antibody
orb667057-04 200 µL

Kir6.1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details