Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alkaline ceramidase (CBG18997)

This Recombinant Alkaline ceramidase (CBG18997) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Alkaline ceramidase, AlkCDase, EC= 3.5.1.23, Alkaline N-acylsphingosine amidohydrolase, Alkaline acylsphingosine deacylase

UniProt

Q60WT2

Expression Region

1-272

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSSSISRWFEYESGHAWCESAYKYQTLPYVAEFANTCTNLPIIVLPLVNIMLLRRYLHD VNGGLVFPQLLLTFNGLASTYYHATLNLFGQLVDELSLVWIITVFLVVYIPVMKWFPERF SKRLTVVRWVVLIVTAVVSALCFLEPNLNAIALMLFSIPAAVVIRYEGKQSGIPDIENFP SRILALWGVAFSFWFADRLLCDFWLYLGTPYLHALFHLLAGLAGYTIFIMFSMIDIESRS KTHRYTAAVRYFPDKNGSIFSFPYISLKERSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Estrogen Sulfotransferase Rabbit pAb
E47R0629 100 µL

Estrogen Sulfotransferase Rabbit pAb

Sign In for Pricing
View Details
RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (MaxLight 650)
MBS6229750-01 0.1 mL

RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (MaxLight 650)

Sign In for Pricing
View Details
RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (MaxLight 650)
MBS6229750-02 5x 0.1 mL

RUNX1 (Runt-Related Transcription Factor 1, AML1, AML1-EVI-1, AMLCR1, CBFA2, EVI-1, PEBP2aB) (MaxLight 650)

Sign In for Pricing
View Details
CCDC34 shRNA (h) Lentiviral Particles
sc-96656-V 200 µL

CCDC34 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
MicroGripper Assembly; box of 20 assemblies
B-M7-A1-B5 20 Mounts/Base Assemblies

MicroGripper Assembly; box of 20 assemblies

Sign In for Pricing
View Details
Mouse Tssk6 (NM_032004) AAV Particle
MR219953A1V 250 µL

Mouse Tssk6 (NM_032004) AAV Particle

Sign In for Pricing
View Details