Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chondrus crispus Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Chondrus crispus Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

P48872

Expression Region

1-272

Origin

Chondrus crispus (Carragheen moss) (Irish moss)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTLSQISKSVQRHPFHLVDPSPWPFVASLCAFSCAIGGVMYMHAYVNGSFILSISFFCL LLVMFTWWRDVIRESTFEGHHTGIVQQGLRFGVILFIISEILFFFAFFWAFFHSSLAPTI EIGSIWPPKGINVLNPWEIPFLNTLILLLSGCTVTWCHHSLVSNLRNQSVLSLFLTIVLA IVFTTFQAYEYSMADFRLSDGIYGSTFYMATGFHGFHVLVGTISLAVCLIRLLQYQLTQQ HHFGFESAAWYWHFVDVVWLFLFVSIYWWGGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Peptide (MaxLight 405) discontinued
C7905-01P-ML405 100 µL

C-Peptide (MaxLight 405) discontinued

Sign In for Pricing
View Details
Giantin polyclonal Guinea pig affinity purified
263 005 50 µg

Giantin polyclonal Guinea pig affinity purified

Sign In for Pricing
View Details
CYP4V2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0554304 1.0 µg DNA

CYP4V2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TPO (B-10) : m-IgGκ BP-HRP Bundle
sc-536086 1 Kit

TPO (B-10) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
TBC1D26 Double Nickase Plasmid (h2)
sc-415668-NIC-2 20 µg

TBC1D26 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Mouse STAB2 shRNA Plasmid
abx980414-01 150 µg

Mouse STAB2 shRNA Plasmid

Sign In for Pricing
View Details