Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chondrus crispus Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Chondrus crispus Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

P48872

Expression Region

1-272

Origin

Chondrus crispus (Carragheen moss) (Irish moss)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTLSQISKSVQRHPFHLVDPSPWPFVASLCAFSCAIGGVMYMHAYVNGSFILSISFFCL LLVMFTWWRDVIRESTFEGHHTGIVQQGLRFGVILFIISEILFFFAFFWAFFHSSLAPTI EIGSIWPPKGINVLNPWEIPFLNTLILLLSGCTVTWCHHSLVSNLRNQSVLSLFLTIVLA IVFTTFQAYEYSMADFRLSDGIYGSTFYMATGFHGFHVLVGTISLAVCLIRLLQYQLTQQ HHFGFESAAWYWHFVDVVWLFLFVSIYWWGGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TPM3 Protein, N-His
orb2969458-01 50 µg

Recombinant Human TPM3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TPM3 Protein, N-His
orb2969458-02 100 µg

Recombinant Human TPM3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TPM3 Protein, N-His
orb2969458-03 1 mg

Recombinant Human TPM3 Protein, N-His

Sign In for Pricing
View Details
GATAD2B (GATA Zinc Finger Domain Containing 2B, FLJ37346, KIAA1150, MGC138257, MGC138285, P66beta, RP11-216N14.6) (MaxLight 650)
MBS6227718-01 0.1 mL

GATAD2B (GATA Zinc Finger Domain Containing 2B, FLJ37346, KIAA1150, MGC138257, MGC138285, P66beta, RP11-216N14.6) (MaxLight 650)

Sign In for Pricing
View Details
GATAD2B (GATA Zinc Finger Domain Containing 2B, FLJ37346, KIAA1150, MGC138257, MGC138285, P66beta, RP11-216N14.6) (MaxLight 650)
MBS6227718-02 5x 0.1 mL

GATAD2B (GATA Zinc Finger Domain Containing 2B, FLJ37346, KIAA1150, MGC138257, MGC138285, P66beta, RP11-216N14.6) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Anti-Mouse Abca6 pAb
PA13373-01 50 μL

Rabbit Anti-Mouse Abca6 pAb

Sign In for Pricing
View Details