Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas mendocina ATP synthase subunit a (atpB)

This Recombinant Pseudomonas mendocina ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A4Y193

Expression Region

1-272

Origin

Pseudomonas mendocina (strain ymp)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADTPAEYIQHHLQNLVYGSHPEKGWIIAQTPEEVKAMGFWAVHVDTLGWSLFMGLIFIT LFRMAAKKAVTGVPSGLQNMAEMCIEFVQGIVKDTFHGKNPLVAPLALTIFVWVFLMNSL KWIPVDYIPGLAHAMGLPYFKIVPTADPNGTFGISLGVFLLIIFYSIKVKGVGGFTKELS FTPFNHWALIPFNLFLEIIGLLTKPLSLALRLFGNMYAGEVVFILIALLPFYVQWGLNVP WAIFHILVIPLQAFIFMVLTVVYLSAAHEDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHTF1 (NM_006608) Human Tagged ORF Clone
RC212729 10 µg

PHTF1 (NM_006608) Human Tagged ORF Clone

Sign In for Pricing
View Details
Klrc2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6815705 3x 1.0 µg

Klrc2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cytokeratin 18 (CK18)
MBS2147423-01 0.1 mL

APC-Linked Monoclonal Antibody to Cytokeratin 18 (CK18)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cytokeratin 18 (CK18)
MBS2147423-02 0.2 mL

APC-Linked Monoclonal Antibody to Cytokeratin 18 (CK18)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cytokeratin 18 (CK18)
MBS2147423-03 0.5 mL

APC-Linked Monoclonal Antibody to Cytokeratin 18 (CK18)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cytokeratin 18 (CK18)
MBS2147423-04 1 mL

APC-Linked Monoclonal Antibody to Cytokeratin 18 (CK18)

Sign In for Pricing
View Details