Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas mendocina ATP synthase subunit a (atpB)

This Recombinant Pseudomonas mendocina ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-272.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A4Y193

Expression Region

1-272

Origin

Pseudomonas mendocina (strain ymp)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADTPAEYIQHHLQNLVYGSHPEKGWIIAQTPEEVKAMGFWAVHVDTLGWSLFMGLIFIT LFRMAAKKAVTGVPSGLQNMAEMCIEFVQGIVKDTFHGKNPLVAPLALTIFVWVFLMNSL KWIPVDYIPGLAHAMGLPYFKIVPTADPNGTFGISLGVFLLIIFYSIKVKGVGGFTKELS FTPFNHWALIPFNLFLEIIGLLTKPLSLALRLFGNMYAGEVVFILIALLPFYVQWGLNVP WAIFHILVIPLQAFIFMVLTVVYLSAAHEDHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tmem45a2 activation kit by CRISPRa
GA208191 1 Kit

Mouse Tmem45a2 activation kit by CRISPRa

Sign In for Pricing
View Details
EV-Loc
K213_2 For 2 Samples

EV-Loc

Sign In for Pricing
View Details
KIAA1539 (FAM214B) (NM_025182) Human Tagged ORF Clone
RG202588 10 µg

KIAA1539 (FAM214B) (NM_025182) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-phospho-FANCG (Ser383) antibody
SL5353R-01 50 µL

Rabbit Anti-phospho-FANCG (Ser383) antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-FANCG (Ser383) antibody
SL5353R-02 100 µL

Rabbit Anti-phospho-FANCG (Ser383) antibody

Sign In for Pricing
View Details
Rabbit anti-Rat IgG Heavy and Light Chain Antibody Affinity Purified
A110-122A 1 mg

Rabbit anti-Rat IgG Heavy and Light Chain Antibody Affinity Purified

Sign In for Pricing
View Details