Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP)

This Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P60932

Expression Region

1-273

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTSGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Hydroxyphthalic Anhydride
TRC-H951270-5G 5 g

3-Hydroxyphthalic Anhydride

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS626926 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
HDAC4 Rabbit Monoclonal Antibody
TA422796 100 µL

HDAC4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human CGβ (Chorionic Gonadotrophin Beta) ELISA Kit
E-EL-H3647-01 24 Tests

Human CGβ (Chorionic Gonadotrophin Beta) ELISA Kit

Sign In for Pricing
View Details
Human CGβ (Chorionic Gonadotrophin Beta) ELISA Kit
E-EL-H3647-02 48 Tests

Human CGβ (Chorionic Gonadotrophin Beta) ELISA Kit

Sign In for Pricing
View Details
Human CGβ (Chorionic Gonadotrophin Beta) ELISA Kit
E-EL-H3647-03 96 Tests

Human CGβ (Chorionic Gonadotrophin Beta) ELISA Kit

Sign In for Pricing
View Details