Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP)

This Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

P60932

Expression Region

1-273

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTSGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SNX29 activation kit by CRISPRa
GA114177 1 Kit

Human SNX29 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytochrome P450 19A1 Antibody
8C12248-AAT 50 µg

Cytochrome P450 19A1 Antibody

Sign In for Pricing
View Details
CDC42 Recombinant Rabbit monoclonal Antibody
HA750320 100 µL

CDC42 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PHF7 (NM_016483) Human Recombinant Protein
TP305192 20 µg

PHF7 (NM_016483) Human Recombinant Protein

Sign In for Pricing
View Details
ROCK2 Human Gene Knockout Kit (CRISPR)
KN217764RB 1 Kit

ROCK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2910), CF568 conjugate, 0.1mg/mL
BNC682910-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2910), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details