Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter propionicus Undecaprenyl-diphosphatase (uppP)

This Recombinant Pelobacter propionicus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A1AV04

Expression Region

1-273

Origin

Pelobacter propionicus (strain DSM 2379)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLLHALILGALQGVTEVLPISSSAHLILVPWLLGWPESGLTFDVALHLGTFLALVVYFR RDIVDMAVSTIDAVKHRSLDTPARRLPFLVIASAVPAALVGKLFETQIEELFRSRPLLIG LFLILFGVGLGLADLFGRKRRFMAQVTVSHALVIGLFQCLALIPGVSRSGITITAGLMLG FNRVGAARFSFLMSLPIVAGAALFKMLHLLDQGIPAGEGLPLAAGIVSSAVTGYISVAFL LRFVQKRSIAPFVWYRLIAGGAVVSVILTGISG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDOR1 CytoSection
TS426636P5 25 Slides

NDOR1 CytoSection

Sign In for Pricing
View Details
HOXA3 Polyclonal Antibody
bs-11292R 100 µL

HOXA3 Polyclonal Antibody

Sign In for Pricing
View Details
ZIC1/2/3 Colorimetric Cell-Based ELISA Kit (OKAG01158)
OKAG01158 96 Well

ZIC1/2/3 Colorimetric Cell-Based ELISA Kit (OKAG01158)

Sign In for Pricing
View Details
ENHO Polyclonal Antibody
MBS8566975-01 0.1 mL

ENHO Polyclonal Antibody

Sign In for Pricing
View Details
ENHO Polyclonal Antibody
MBS8566975-02 0.1 mL (AF405L)

ENHO Polyclonal Antibody

Sign In for Pricing
View Details
ENHO Polyclonal Antibody
MBS8566975-03 0.1 mL (AF405S)

ENHO Polyclonal Antibody

Sign In for Pricing
View Details