Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter propionicus Undecaprenyl-diphosphatase (uppP)

This Recombinant Pelobacter propionicus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A1AV04

Expression Region

1-273

Origin

Pelobacter propionicus (strain DSM 2379)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLLHALILGALQGVTEVLPISSSAHLILVPWLLGWPESGLTFDVALHLGTFLALVVYFR RDIVDMAVSTIDAVKHRSLDTPARRLPFLVIASAVPAALVGKLFETQIEELFRSRPLLIG LFLILFGVGLGLADLFGRKRRFMAQVTVSHALVIGLFQCLALIPGVSRSGITITAGLMLG FNRVGAARFSFLMSLPIVAGAALFKMLHLLDQGIPAGEGLPLAAGIVSSAVTGYISVAFL LRFVQKRSIAPFVWYRLIAGGAVVSVILTGISG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camk2d 3'UTR GFP Stable Cell Line
TU251605 1.0 mL

Camk2d 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tamrintamab
E40YR1546 1 mg

Tamrintamab

Sign In for Pricing
View Details
High Mobility Group Nucleosome-Binding Domain-Containing Protein 4 (HMGN4) Antibody
abx036078-01 100 µg

High Mobility Group Nucleosome-Binding Domain-Containing Protein 4 (HMGN4) Antibody

Sign In for Pricing
View Details
High Mobility Group Nucleosome-Binding Domain-Containing Protein 4 (HMGN4) Antibody
abx036078-02 1 mg

High Mobility Group Nucleosome-Binding Domain-Containing Protein 4 (HMGN4) Antibody

Sign In for Pricing
View Details
Anti-FASL/FASLG Antibody Picoband® Fluoro550 Conjugated
A00925-2-Fluoro550 100 µg/Vial

Anti-FASL/FASLG Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
CD5 (CD5 antigen (p56 62), LEU1, Ly12, LyA, Lymphocyte antigen T1/Leu-1, Lymphocyte glycoprotein T1/Leu1, T-cell surface glycoprotein CD5) (AP) discontinued
168705-AF-AP 100 µL

CD5 (CD5 antigen (p56 62), LEU1, Ly12, LyA, Lymphocyte antigen T1/Leu-1, Lymphocyte glycoprotein T1/Leu1, T-cell surface glycoprotein CD5) (AP) discontinued

Sign In for Pricing
View Details