Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharopolyspora erythraea Undecaprenyl-diphosphatase (uppP)

This Recombinant Saccharopolyspora erythraea Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A4FFN9

Expression Region

1-273

Origin

Saccharopolyspora erythraea (strain NRRL 23338)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQAMVLAVVQGLTEFLPISSSGHLSIVSKLFFGSDAGASFTAVTQIGTELAVVIYFAGDI VRLVVTWFRGLVNAEVRRTQDYRLAWYVIVGSLPIGVLGFLFQDYIRGALRSLWITGAML ILFGILMGLAERFGAQRRGHDKLTMRDGVLMGSAQALALIPGVSRSGGTITAGLSLGLDR PTAVRFSFLLAIPAVFAAGVSEVSHVFEPSAHGLQPTGAQMIVATVVAGVVGYAVIAWLL RYVQKHSVYLFVWYRIVLGLVLFGLLGFGVIQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ILVBL Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E9]
TA503141BM 100 µL

ILVBL Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E9]

Sign In for Pricing
View Details
Rat Cys-C Antibody Pair Set
E-KAB-0651 50 µL & 100 µg

Rat Cys-C Antibody Pair Set

Sign In for Pricing
View Details
Human THAP9 activation kit by CRISPRa
GA112579 1 Kit

Human THAP9 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS505847 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
High frequency desktop ultrasonic Cleaner BULC-503
BULC-503 Each

High frequency desktop ultrasonic Cleaner BULC-503

Sign In for Pricing
View Details
Cask Mouse Gene Knockout Kit (CRISPR)
KN502559 1 Kit

Cask Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details