Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharopolyspora erythraea Undecaprenyl-diphosphatase (uppP)

This Recombinant Saccharopolyspora erythraea Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A4FFN9

Expression Region

1-273

Origin

Saccharopolyspora erythraea (strain NRRL 23338)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQAMVLAVVQGLTEFLPISSSGHLSIVSKLFFGSDAGASFTAVTQIGTELAVVIYFAGDI VRLVVTWFRGLVNAEVRRTQDYRLAWYVIVGSLPIGVLGFLFQDYIRGALRSLWITGAML ILFGILMGLAERFGAQRRGHDKLTMRDGVLMGSAQALALIPGVSRSGGTITAGLSLGLDR PTAVRFSFLLAIPAVFAAGVSEVSHVFEPSAHGLQPTGAQMIVATVVAGVVGYAVIAWLL RYVQKHSVYLFVWYRIVLGLVLFGLLGFGVIQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-3 Polyclonal Antibody
AN006080L-01 25 µL

IL-3 Polyclonal Antibody

Sign In for Pricing
View Details
IL-3 Polyclonal Antibody
AN006080L-02 100 µL

IL-3 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS504066 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Lgals1 (NM_008495) Mouse Tagged ORF Clone
MG200810 10 µg

Lgals1 (NM_008495) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD28 Human Recombinant Protein
TP723937 100 µg

CD28 Human Recombinant Protein

Sign In for Pricing
View Details
Rsl24d1 Mouse Gene Knockout Kit (CRISPR)
KN515162 1 Kit

Rsl24d1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details