Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Enterobacter sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A4WEI9

Expression Region

1-273

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLVAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGETAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPPQHEGEGKGRLTLIHILLGMVPAVVLGLIFHDAIKSLFNPI NVMYALVVGGVLLIAAELLKPKEPKAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSYHFLTAADFPMFAVGFVTAFLVALV AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Animal-Free Nodal, Human (His)
HY-P700025AF-01 2 µg

Animal-Free Nodal, Human (His)

Sign In for Pricing
View Details
Animal-Free Nodal, Human (His)
HY-P700025AF-02 10 µg

Animal-Free Nodal, Human (His)

Sign In for Pricing
View Details
Animal-Free Nodal, Human (His)
HY-P700025AF-03 50 µg

Animal-Free Nodal, Human (His)

Sign In for Pricing
View Details
Animal-Free Nodal, Human (His)
HY-P700025AF-04 100 µg

Animal-Free Nodal, Human (His)

Sign In for Pricing
View Details
Palmd (NM_001025688) Rat Tagged ORF Clone Lentiviral Particle
RR201481L4V 200 µL

Palmd (NM_001025688) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
V-ATPase D (m) -PR
sc-36792-PR 10 µM - 20 µL

V-ATPase D (m) -PR

Sign In for Pricing
View Details