Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Enterobacter sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A4WEI9

Expression Region

1-273

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLVAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGETAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPPQHEGEGKGRLTLIHILLGMVPAVVLGLIFHDAIKSLFNPI NVMYALVVGGVLLIAAELLKPKEPKAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSYHFLTAADFPMFAVGFVTAFLVALV AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL38 (NM_000999) Human Over-expression Lysate
LS006169-100ug 100 µg

RPL38 (NM_000999) Human Over-expression Lysate

Sign In for Pricing
View Details
EEF1G Rabbit Polyclonal Antibody (HRP)
orb3129230 100 µg

EEF1G Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TRPM8 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-61651R-PE-Cy5.5 100 µL

TRPM8 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-INAVA Antibody Picoband® Fluoro647 Conjugated
A32411-Fluoro647 100 µg/Vial

Anti-INAVA Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
hsa-miR-323b-5p miRNA Inhibitor
MBS8293020-01 10 nmol

hsa-miR-323b-5p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-323b-5p miRNA Inhibitor
MBS8293020-02 20 nmol

hsa-miR-323b-5p miRNA Inhibitor

Sign In for Pricing
View Details