Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Enterobacter sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A4WEI9

Expression Region

1-273

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLVAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGETAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPPQHEGEGKGRLTLIHILLGMVPAVVLGLIFHDAIKSLFNPI NVMYALVVGGVLLIAAELLKPKEPKAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSYHFLTAADFPMFAVGFVTAFLVALV AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF516 (NM_014643) Human Untagged Clone
SC304148 10 µg

ZNF516 (NM_014643) Human Untagged Clone

Sign In for Pricing
View Details
CUGBP2 antibody - N-terminal region (ARP40667_P050)
ARP40667_P050 100 µL

CUGBP2 antibody - N-terminal region (ARP40667_P050)

Sign In for Pricing
View Details
GRB14 Rabbit Polyclonal Antibody (Fluoro550)
orb3106257 100 µg

GRB14 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Factor XI Inhibitor Plasma
MBS514052 3x 1 mL

Factor XI Inhibitor Plasma

Sign In for Pricing
View Details
Rat Tachykinin Receptor 1 (TACR1) ELISA Kit
MBS2709857-01 24 Strip Well

Rat Tachykinin Receptor 1 (TACR1) ELISA Kit

Sign In for Pricing
View Details
Rat Tachykinin Receptor 1 (TACR1) ELISA Kit
MBS2709857-02 48 Well

Rat Tachykinin Receptor 1 (TACR1) ELISA Kit

Sign In for Pricing
View Details