Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae Undecaprenyl-diphosphatase (uppP)

This Recombinant Salmonella arizonae Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A9MPV8

Expression Region

1-273

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQREGESKGQLTLIHILLGMIPAMVLGLVFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLSAADIPMFAVGFVTAFVVALI AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB520484 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Tfam (C-term) Rabbit Polyclonal Antibody
AP26439SU-N 100 µL

Tfam (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SIRT1 Antibody
KC-7277-01 50 μL

SIRT1 Antibody

Sign In for Pricing
View Details
SIRT1 Antibody
KC-7277-02 100 µL

SIRT1 Antibody

Sign In for Pricing
View Details
SIRT1 Antibody
KC-7277-03 1 mL

SIRT1 Antibody

Sign In for Pricing
View Details
LRATD2 Rabbit Polyclonal Antibody
TA372545 100 µL

LRATD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details