Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Undecaprenyl-diphosphatase (uppP)

This Recombinant Salmonella paratyphi A Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B5BG16

Expression Region

1-273

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRQLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALI AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9-Hydroxyellipticine Hydrochloride
TRC-H949683-50MG 50 mg

9-Hydroxyellipticine Hydrochloride

Sign In for Pricing
View Details
Polystyrene A Sulfonic Acid
HA1602000430.25G 25 g

Polystyrene A Sulfonic Acid

Sign In for Pricing
View Details
rac Pimobendan
TRC-P447500-5MG 5 mg

rac Pimobendan

Sign In for Pricing
View Details
Human OR5V1 activation kit by CRISPRa
GA113112 1 Kit

Human OR5V1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human LTF Antibody Pair Set
E-KAB-0175 50 µL & 100 µg

Human LTF Antibody Pair Set

Sign In for Pricing
View Details
CD19 (B-Lymphocyte Marker) (CD19/3116), CF488A conjugate, 0.1mg/mL
BNC883116-100 1x 100 µL

CD19 (B-Lymphocyte Marker) (CD19/3116), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details