Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Undecaprenyl-diphosphatase (uppP)

This Recombinant Salmonella paratyphi C Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

C0PYX8

Expression Region

1-273

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI NVMYTLVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALI AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Os11g0569800 protein Rabbit Polyclonal Antibody
HA500434 100 µL

Os11g0569800 protein Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KBTBD11 (NM_014867) Human Recombinant Protein
TP320263 20 µg

KBTBD11 (NM_014867) Human Recombinant Protein

Sign In for Pricing
View Details
HDHD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E9]
TA503014BM 100 µL

HDHD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E9]

Sign In for Pricing
View Details
Recombinant Human Lysozyme G-like 1/LYG1 Protein (His Tag)
PKSH030627 100 µg

Recombinant Human Lysozyme G-like 1/LYG1 Protein (His Tag)

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF488A conjugate, 0.1mg/mL
BNC881950-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
A2LD1 (GGACT) (NM_033110) Human Recombinant Protein
TP720202L 500 µg

A2LD1 (GGACT) (NM_033110) Human Recombinant Protein

Sign In for Pricing
View Details