Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP)

This Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

C4ZQX4

Expression Region

1-273

Origin

Escherichia coli (strain K12 / MC4100 / BW2952)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTSGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cftr shRNA (UAS) - Lentiviral mouse Cftr shRNA (UAS, GFP) (100)
GTR15191217 1 Vial

Lentiviral mouse Cftr shRNA (UAS) - Lentiviral mouse Cftr shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
FBXL8 Recombinant Protein (Rat)
RP200972 100 µg

FBXL8 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Hepatitis C Virus NS3, c33c, aa1192-1459, Genotype 2b, Recombinant (HCV)
MBS636773-01 1 mg

Hepatitis C Virus NS3, c33c, aa1192-1459, Genotype 2b, Recombinant (HCV)

Sign In for Pricing
View Details
Hepatitis C Virus NS3, c33c, aa1192-1459, Genotype 2b, Recombinant (HCV)
MBS636773-02 5x 1 mg

Hepatitis C Virus NS3, c33c, aa1192-1459, Genotype 2b, Recombinant (HCV)

Sign In for Pricing
View Details
Human CNOT11 shRNA Plasmid
abx960744-01 150 µg

Human CNOT11 shRNA Plasmid

Sign In for Pricing
View Details
Human CNOT11 shRNA Plasmid
abx960744-02 300 µg

Human CNOT11 shRNA Plasmid

Sign In for Pricing
View Details