Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lysinibacillus sphaericus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Lysinibacillus sphaericus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

B1HVP3

Expression Region

1-273

Origin

Lysinibacillus sphaericus (strain C3-41)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLLLLQINPIAFHLGPIPVRWYGLLIVSGIILAYVVGQREAVKRGLPEDFLADLLLWAV PISIICARIYYVSMRWDYYSENPGKIIEIWNGGIAIHGALIGAFVTAYIFTRIKNVSFLR VADIAAPSILIGQIIGRWGNFMNQEAYGGPVSKEFLENLMLPDWIINQMYIEELGTYVHP TFLYESVWNLIGLIILLILRKVNLNRGEIFFSYLIWYSIGRFYIEGMRTDSLYLVGDLRS AQIVSIIGIVVGLGAIIYRRIKVKPAMKYLDNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adrafinil
TRC-A301500-25MG 25 mg

Adrafinil

Sign In for Pricing
View Details
N-Acetyl Serotonine O-Sulfate Ester Triethylammonium Salt
TRC-A188365-5MG 5 mg

N-Acetyl Serotonine O-Sulfate Ester Triethylammonium Salt

Sign In for Pricing
View Details
p38 (CRK) Human Gene Knockout Kit (CRISPR)
KN401701 1 Kit

p38 (CRK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Carboxypeptidase A (CPA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F1]
TA500170AM 100 µL

Carboxypeptidase A (CPA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F1]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS507774 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
IDH2 Recombinant Rabbit Monoclonal Antibody [JA55-31]
ET1704-93 100 µL

IDH2 Recombinant Rabbit Monoclonal Antibody [JA55-31]

Sign In for Pricing
View Details