Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alkaline ceramidase 1 (Acer1)

This Recombinant Mouse Alkaline ceramidase 1 (Acer1) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Alkaline ceramidase 1, AlkCDase 1, Alkaline CDase 1, maCER1, EC= 3.5.1.23, Acylsphingosine deacylase 3, N-acylsphingosine amidohydrolase 3

UniProt

Q8R4X1

Expression Region

1-273

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPY AQKRTRCFYGVSVLFMLIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPK FVKGNRFYFSCLVTITTIISTFLTFVKPTVNAYALNSIAIHILYIVRTEYKKIRDDDLRH LIAVSVVLWAAALTSWISDRVLCSFWQRIHFYYLHSIWHVLISITFPYGIVTMALVDAKY EMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TRIM27 Protein, N-His
orb2833943-01 20 µg

Recombinant Human TRIM27 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TRIM27 Protein, N-His
orb2833943-02 50 µg

Recombinant Human TRIM27 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TRIM27 Protein, N-His
orb2833943-03 100 µg

Recombinant Human TRIM27 Protein, N-His

Sign In for Pricing
View Details
mmu-miR-6929-3p miRNA Antagomir
MNM02603 2x 5.0 nmol

mmu-miR-6929-3p miRNA Antagomir

Sign In for Pricing
View Details
TEX19 (Testis-Expressed Sequence 19 Protein)
T3543-39 100 µg

TEX19 (Testis-Expressed Sequence 19 Protein)

Sign In for Pricing
View Details
PLEKHA1 siRNA (Human)
MBS8218268-01 15 nmol

PLEKHA1 siRNA (Human)

Sign In for Pricing
View Details