Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosomonas eutropha Undecaprenyl-diphosphatase (uppP)

This Recombinant Nitrosomonas eutropha Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q0AJJ0

Expression Region

1-273

Origin

Nitrosomonas eutropha (strain C91)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWLILIKAFLLGIVEGLTEFLPISSTGHLILAGDLLDFNDDKAQVFTVAIQLGAILSVC WEYRARLINVARGWGTRRANRFVLNLCVAFLPAAILGLLFIKTIKYYLFHPLPVAIALVT GGVLILWAERREHRIEVENVDDMNWKHALKIGCAQCLALIPGTSRSGATIIGGLLSGLSR KAAAEFSFFLAIPIMFAATFYDVYKHREFLHSDDLGMFVVGSIAAFISALIAIRGFIRYV SHHDFTLFAWYRIGFGLIVLLTAHFGLINWSAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gallic acid 4-O-β-D-glucopyranoside
TN8763-01 10 mg

Gallic acid 4-O-β-D-glucopyranoside

Sign In for Pricing
View Details
Gallic acid 4-O-β-D-glucopyranoside
TN8763-02 50 mg

Gallic acid 4-O-β-D-glucopyranoside

Sign In for Pricing
View Details
Nicotinic Acetylcholine Receptor alpha 6 (cholinergic receptor, nicotinic, alpha 6 Precursor) (MaxLight 405) discontinued
N2563-03-ML405 100 µL

Nicotinic Acetylcholine Receptor alpha 6 (cholinergic receptor, nicotinic, alpha 6 Precursor) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Phorate sulfoxide
CS-T-60523 1 Each

Phorate sulfoxide

Sign In for Pricing
View Details
Mouse Ascc2 Pre-designed siRNA Set A
SI101035A 1 Each

Mouse Ascc2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SSR2 Antibody (FITC)
orb515808-01 50 µg

SSR2 Antibody (FITC)

Sign In for Pricing
View Details