Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP)

This Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q1R6S4

Expression Region

1-273

Origin

Escherichia coli (strain UTI89 / UPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTTGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNA4 (NM_021068) Human Recombinant Protein
TP323649L 1 mg

IFNA4 (NM_021068) Human Recombinant Protein

Sign In for Pricing
View Details
PGM2L1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F5]
TA812137BM 100 µL

PGM2L1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F5]

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1842), CF594 conjugate, 0.1mg/mL
BNC941842-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/1842), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RHOF Rabbit Polyclonal Antibody
TA371075 100 µL

RHOF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IKZF3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B9]
TA804393BM 100 µL

IKZF3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B9]

Sign In for Pricing
View Details
Ssb Mouse Gene Knockout Kit (CRISPR)
KN516755 1 Kit

Ssb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details