Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosospira multiformis Undecaprenyl-diphosphatase (uppP)

This Recombinant Nitrosospira multiformis Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q2Y6P3

Expression Region

1-273

Origin

Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWFLLLKGLILGIVEGLTEFLPISSTGHLILVSDLLNFNDEKGKVFTIVIQLGAILAVC WEYRVKLRHVVTDIGSRQDANRFVLNLLIAFLPAAILGLLFIKTIKQYLFHPVPVALAFI VGGLLILWAERRPHVVDVERVEDMDWKHALKVGLAQCLALIPGTSRSGATIIGGLFFGLS RKAATEFSFFLAIPVMFAATFYDLYKNRDILHLDDASVFAIGFVASFISALLAVRGLLRF VSQHDFSVFAWYRIGFGIIVLITAYSGMVQWSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 Antibody - C-terminal region : HRP (ARP60994_P050-HRP)
ARP60994_P050-HRP 100 µL

CD34 Antibody - C-terminal region : HRP (ARP60994_P050-HRP)

Sign In for Pricing
View Details
NCF2 siRNA (Human)
orb1865155-01 15 nmol

NCF2 siRNA (Human)

Sign In for Pricing
View Details
NCF2 siRNA (Human)
orb1865155-02 30 nmol

NCF2 siRNA (Human)

Sign In for Pricing
View Details
GRIN1 293 Cell Lysate
410125 0.1 mg

GRIN1 293 Cell Lysate

Sign In for Pricing
View Details
GRF (1-29) amide (human)
M40230-01 100 mg

GRF (1-29) amide (human)

Sign In for Pricing
View Details
GRF (1-29) amide (human)
M40230-02 25 mg

GRF (1-29) amide (human)

Sign In for Pricing
View Details