Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Undecaprenyl-diphosphatase (uppP)

This Recombinant Salmonella paratyphi A Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q5PC81

Expression Region

1-273

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRQLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALI AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FCRL2 antibody
STJ112362 100 µl

Anti-FCRL2 antibody

Sign In for Pricing
View Details
ANGPTL6 Antibody
MBS852394-01 0.1 mg

ANGPTL6 Antibody

Sign In for Pricing
View Details
ANGPTL6 Antibody
MBS852394-02 0.1 mL (AF405L)

ANGPTL6 Antibody

Sign In for Pricing
View Details
ANGPTL6 Antibody
MBS852394-03 0.1 mL (AF405S)

ANGPTL6 Antibody

Sign In for Pricing
View Details
ANGPTL6 Antibody
MBS852394-04 0.1 mL (AF610)

ANGPTL6 Antibody

Sign In for Pricing
View Details
ANGPTL6 Antibody
MBS852394-05 0.1 mL (AF635)

ANGPTL6 Antibody

Sign In for Pricing
View Details