Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Undecaprenyl-diphosphatase (uppP)

This Recombinant Salmonella paratyphi A Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q5PC81

Expression Region

1-273

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRQLFGLIGIHFGRPLQREGESKGRLTLIHILLGMIPAVVLGLVFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATVLDLYKSWSFLTAADIPMFAVGFVTAFVVALI AIKTFLQLIKRISFIPFAIYRFVVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC2 (DnaJ Homolog Subfamily C Member 2, ZRF1, ZUO1, MPP11, MPHOSPH11) (MaxLight 750)
MBS6414405-01 0.1 mL

DNAJC2 (DnaJ Homolog Subfamily C Member 2, ZRF1, ZUO1, MPP11, MPHOSPH11) (MaxLight 750)

Sign In for Pricing
View Details
DNAJC2 (DnaJ Homolog Subfamily C Member 2, ZRF1, ZUO1, MPP11, MPHOSPH11) (MaxLight 750)
MBS6414405-02 5x 0.1 mL

DNAJC2 (DnaJ Homolog Subfamily C Member 2, ZRF1, ZUO1, MPP11, MPHOSPH11) (MaxLight 750)

Sign In for Pricing
View Details
Phospho-FLT3 (Tyr969) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-3151R-APC-Cy5.5 100 µL

Phospho-FLT3 (Tyr969) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
SLC16A7 Rabbit Polyclonal Antibody
E10G11020 100 µL

SLC16A7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse 1110012L19Rik shRNA (UAS) - Lentiviral mouse 1110012L19Rik shRNA (UAS, iRFP) plasmid
GTR15180916 1 Vial

Lentiviral mouse 1110012L19Rik shRNA (UAS) - Lentiviral mouse 1110012L19Rik shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PDE3B (cGMP-inhibited 3',5'-cyclic Phosphodiesterase B, CGIPDE1, Cyclic GMP-inhibited Phosphodiesterase B) (MaxLight 405)
MBS6191713-01 0.1 mL

PDE3B (cGMP-inhibited 3',5'-cyclic Phosphodiesterase B, CGIPDE1, Cyclic GMP-inhibited Phosphodiesterase B) (MaxLight 405)

Sign In for Pricing
View Details