Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter sp. Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Acinetobacter sp. Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q6FER4

Expression Region

1-273

Origin

Acinetobacter sp. (strain ADP1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTYPNIDPVALSLGPLKVHWYGLMYLLAFLCAWGLASYRAKQRDSWTSEMVSDLVFYGA LGVVLGGRVGYVLFYEFDKFLANPIWLFQVWTGGMSFHGGFIGVMLAMILWCRKYQKTWF ETLDFIAPCVPTGLMFGRIGNFIGAELYGREVQDPNYPFGMIFPTDPFHLVRHPSQIYQA ICEGLLLFILLWWFSSKPRPRMAVSALFLMGYGVARFVVEFFREPDADQGFILFGWMTKG QILTVPMLLIGLWMIWYAYQRKVYDWGPLKTHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Actinin Alpha 2 (ACTN2) ELISA Kit
MBS2022670-01 24 Strip Well

Human Actinin Alpha 2 (ACTN2) ELISA Kit

Sign In for Pricing
View Details
Human Actinin Alpha 2 (ACTN2) ELISA Kit
MBS2022670-02 48 Well

Human Actinin Alpha 2 (ACTN2) ELISA Kit

Sign In for Pricing
View Details
Human Actinin Alpha 2 (ACTN2) ELISA Kit
MBS2022670-03 96 Well

Human Actinin Alpha 2 (ACTN2) ELISA Kit

Sign In for Pricing
View Details
Human Actinin Alpha 2 (ACTN2) ELISA Kit
MBS2022670-04 5x 96 Well

Human Actinin Alpha 2 (ACTN2) ELISA Kit

Sign In for Pricing
View Details
Human Actinin Alpha 2 (ACTN2) ELISA Kit
MBS2022670-05 10x 96 Well

Human Actinin Alpha 2 (ACTN2) ELISA Kit

Sign In for Pricing
View Details
Goat Cadherin-16 (CDH16) ELISA Kit
MBS7252280-01 48 Well

Goat Cadherin-16 (CDH16) ELISA Kit

Sign In for Pricing
View Details