Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter sp. Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Acinetobacter sp. Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q6FER4

Expression Region

1-273

Origin

Acinetobacter sp. (strain ADP1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTYPNIDPVALSLGPLKVHWYGLMYLLAFLCAWGLASYRAKQRDSWTSEMVSDLVFYGA LGVVLGGRVGYVLFYEFDKFLANPIWLFQVWTGGMSFHGGFIGVMLAMILWCRKYQKTWF ETLDFIAPCVPTGLMFGRIGNFIGAELYGREVQDPNYPFGMIFPTDPFHLVRHPSQIYQA ICEGLLLFILLWWFSSKPRPRMAVSALFLMGYGVARFVVEFFREPDADQGFILFGWMTKG QILTVPMLLIGLWMIWYAYQRKVYDWGPLKTHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC17 Rabbit Polyclonal Antibody (BF594)
orb2484985 100 µL

MUC17 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Eosin Y with Phloxine
RRSP38-E 1 L

Eosin Y with Phloxine

Sign In for Pricing
View Details
Fam40a 3'UTR Luciferase Stable Cell Line
TU106262 1.0 mL

Fam40a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Aggrecan Core Protein (ACAN) Antibody (Biotin)
abx272209-01 200 µL

Aggrecan Core Protein (ACAN) Antibody (Biotin)

Sign In for Pricing
View Details
Aggrecan Core Protein (ACAN) Antibody (Biotin)
abx272209-02 1 mL

Aggrecan Core Protein (ACAN) Antibody (Biotin)

Sign In for Pricing
View Details
Glg1 sgRNA CRISPR Lentivector set (Mouse)
K4781001 3x 1.0 µg

Glg1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details