Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria meningitidis serogroup B Undecaprenyl-diphosphatase (uppP)

This Recombinant Neisseria meningitidis serogroup B Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q9K0Z3

Expression Region

1-273

Origin

Neisseria meningitidis serogroup B (strain MC58)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFLIVLKALMMGLVEGFTEFLPISSTGHLIVFGNLIGFHSNHKVFEIAIQLGAVLAVVF EYRQRFSNVLHGLGKDRKANRFVLNLAIAFIPAAVMGLLFGKQIKEYLFNPLSVAVMLVL GGFFILWVEKRQSRAEPKIADVDALRPIDALMIGVAQVFALVPGTSRSGSTIMGGMLWGI ERKTATEFSFFLAVPMMVAATAYDVLKHYRFFTLHDVGLILIGFIAAFVSGLVAVKALLR FVSKKNYIPFAYYRIVFGIAIIILWLSGWISWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (ICO-30), CF594 conjugate, 0.1mg/mL
BNC940364-500 1x 500 µL

Human IgM Immunoglobulin (ICO-30), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR501), CF568 conjugate, 0.1mg/mL
BNC680501-100 1x 100 µL

Progesterone Receptor (PR501), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details