Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Long-wave-sensitive opsin 1 (OPN1LW)

This Recombinant Horse Long-wave-sensitive opsin 1 (OPN1LW) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Long-wave-sensitive opsin 1, Red cone photoreceptor pigment, Red-sensitive opsin

UniProt

O18912

Expression Region

1-273

Origin

Equus caballus (Horse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APRWVYHVTSAWMIFVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAVADLAETIIAS TISVVNQIYGYFVLGHPMCVVEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAK LAVAGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITC CIIPLSVIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMVFAFCLCWGPYTFF ACFAAAHPGYAFHPLVAALPAYFAKSATIYNPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFB10 Antibody
KC-27012-01 50 μL

NDUFB10 Antibody

Sign In for Pricing
View Details
NDUFB10 Antibody
KC-27012-02 100 µL

NDUFB10 Antibody

Sign In for Pricing
View Details
NDUFB10 Antibody
KC-27012-03 1 mL

NDUFB10 Antibody

Sign In for Pricing
View Details
Ak3 Mouse Gene Knockout Kit (CRISPR)
KN501056 1 Kit

Ak3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNA Polymerase theta (POLQ) Human Gene Knockout Kit (CRISPR)
KN212566RB 1 Kit

DNA Polymerase theta (POLQ) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dysferlin interacting protein 1 (PPP1R27) (NM_001007533) Human Recombinant Protein
TP310807M 100 µg

Dysferlin interacting protein 1 (PPP1R27) (NM_001007533) Human Recombinant Protein

Sign In for Pricing
View Details