Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (ctaE)

This Recombinant Cytochrome c oxidase subunit 3 (ctaE) spans the amino acid sequence from region 2-274.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome aa3 subunit 3, Cytochrome c oxidase polypeptide III, Oxidase aa (3) subunit 3

UniProt

P06030

Expression Region

2-274

Origin

Paracoccus denitrificans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AHVKNHDYQILPPSIWPFFGAIGAFVMLTGAVAWMKGITFFGLPVEGPWMFLIGLVGVLY VMFGWWADVVNEGETGEHTPVVRIGLQYGFILFIMSEVMFFVAWFWAFIKNALYPMGPDS PIKDGVWPPEGIVTFDPWHLPLINTLILLLSGVAVTWAHHAFVLEGDRKTTINGLIVAVI LGVCFTGLQAYEYSHAAFGLADTVYAGAFYMATGFHGAHVIIGTIFLFVCLIRLLKGQMT QKQHVGFEAAAWYWHFVDVVWLFLFVVIYIWGR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLI1 Antibody
A78748-100UL 100 µL

OLI1 Antibody

Sign In for Pricing
View Details
KLKB1 Antibody, HRP conjugated
A27081-100UG 100 µg

KLKB1 Antibody, HRP conjugated

Sign In for Pricing
View Details
P-Elk-1 (B-4) Alexa Fluor® 647
sc-8406 AF647 200 µg/mL

P-Elk-1 (B-4) Alexa Fluor® 647

Sign In for Pricing
View Details
PPP1R2 Protein Vector (Rat) (pPB-C-His)
PV295666 500 ng

PPP1R2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
CBX2 Human shRNA Lentiviral Particle (Locus ID 84733)
TL314173V 500 µL Each

CBX2 Human shRNA Lentiviral Particle (Locus ID 84733)

Sign In for Pricing
View Details
CD16 (FCGR3A) Mouse Monoclonal Antibody [Clone ID: 3G8]
SM1072APC 100 Tests

CD16 (FCGR3A) Mouse Monoclonal Antibody [Clone ID: 3G8]

Sign In for Pricing
View Details