Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (ctaE)

This Recombinant Cytochrome c oxidase subunit 3 (ctaE) spans the amino acid sequence from region 2-274.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome aa3 subunit 3, Cytochrome c oxidase polypeptide III, Oxidase aa (3) subunit 3

UniProt

P06030

Expression Region

2-274

Origin

Paracoccus denitrificans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AHVKNHDYQILPPSIWPFFGAIGAFVMLTGAVAWMKGITFFGLPVEGPWMFLIGLVGVLY VMFGWWADVVNEGETGEHTPVVRIGLQYGFILFIMSEVMFFVAWFWAFIKNALYPMGPDS PIKDGVWPPEGIVTFDPWHLPLINTLILLLSGVAVTWAHHAFVLEGDRKTTINGLIVAVI LGVCFTGLQAYEYSHAAFGLADTVYAGAFYMATGFHGAHVIIGTIFLFVCLIRLLKGQMT QKQHVGFEAAAWYWHFVDVVWLFLFVVIYIWGR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDA7 Antibody
orb851863 2 mg

TDA7 Antibody

Sign In for Pricing
View Details
Phospho-FGFR1 (Tyr653 + Tyr654) Rabbit Polyclonal Antibody (BF405)
orb2432422 100 µL

Phospho-FGFR1 (Tyr653 + Tyr654) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
DZIP3 Recombinant Protein Antigen
NBP2-58053PEP 100 µL

DZIP3 Recombinant Protein Antigen

Sign In for Pricing
View Details
Malabaricone B
M24641-01 1 g

Malabaricone B

Sign In for Pricing
View Details
Malabaricone B
M24641-02 100 mg

Malabaricone B

Sign In for Pricing
View Details
Malabaricone B
M24641-03 200 mg

Malabaricone B

Sign In for Pricing
View Details