Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (ctaE)

This Recombinant Cytochrome c oxidase subunit 3 (ctaE) spans the amino acid sequence from region 2-274.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome aa3 subunit 3, Cytochrome c oxidase polypeptide III, Oxidase aa (3) subunit 3

UniProt

P06030

Expression Region

2-274

Origin

Paracoccus denitrificans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AHVKNHDYQILPPSIWPFFGAIGAFVMLTGAVAWMKGITFFGLPVEGPWMFLIGLVGVLY VMFGWWADVVNEGETGEHTPVVRIGLQYGFILFIMSEVMFFVAWFWAFIKNALYPMGPDS PIKDGVWPPEGIVTFDPWHLPLINTLILLLSGVAVTWAHHAFVLEGDRKTTINGLIVAVI LGVCFTGLQAYEYSHAAFGLADTVYAGAFYMATGFHGAHVIIGTIFLFVCLIRLLKGQMT QKQHVGFEAAAWYWHFVDVVWLFLFVVIYIWGR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine RING finger protein 113A, RNF113A ELISA KIT
ELI-37940b 96 Tests

Bovine RING finger protein 113A, RNF113A ELISA KIT

Sign In for Pricing
View Details
Human αN-acetylglucosaminidase, αNAG ELISA Kit
YLA1654HU-01 48 Tests

Human αN-acetylglucosaminidase, αNAG ELISA Kit

Sign In for Pricing
View Details
Human αN-acetylglucosaminidase, αNAG ELISA Kit
YLA1654HU-02 96 Tests

Human αN-acetylglucosaminidase, αNAG ELISA Kit

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF543 conjugate, 0.1mg/mL
BNC432615-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Samarium 2,4-Pentanedionate
sc-258136A 10 g

Samarium 2,4-Pentanedionate

Sign In for Pricing
View Details
GPR85 Polyclonal Antibody
orb1419669 100 µL

GPR85 Polyclonal Antibody

Sign In for Pricing
View Details