Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Janthinobacterium sp. ATP synthase subunit a (atpB)

This Recombinant Janthinobacterium sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A6T476

Expression Region

1-273

Origin

Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDHAAPTASEYIVHHLGHFSTKHQDKIVDFSIINMDTIFWSIFAGVVGCLFMYLAARK ATSGVPGRFQAAVEMIVEMVDNQAKSIVHGDRTFIAPLALTVFVWVALMNSLDFLPVDMF SAFFHAVGLDSLITHHRVVPTADLNGTMGIALGVFALMIFYNIKIKGAGGFVHELFAAPF GIWLAPFNLLLNMIEFAAKTVSLAMRLFGNMYAGELLFLLIALLGSTATAFGFFGHVVAG TLWAIFHILIVFLQAFIFMMLTLVYIGQAHESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPM6B Rabbit pAb, BF700 conjugated
orb2878697 100 µL

GPM6B Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Mouse Ahnak Pre-designed siRNA Set B
SI100425B 1 Each

Mouse Ahnak Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human TLR5 Protein Lysate
MBS8428606-01 0.02 mg

Human TLR5 Protein Lysate

Sign In for Pricing
View Details
Human TLR5 Protein Lysate
MBS8428606-02 5x 0.02 mg

Human TLR5 Protein Lysate

Sign In for Pricing
View Details
C-RAF Antibody
MBS9503653-01 0.05 mL

C-RAF Antibody

Sign In for Pricing
View Details
C-RAF Antibody
MBS9503653-02 0.1 mL

C-RAF Antibody

Sign In for Pricing
View Details