Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Janthinobacterium sp. ATP synthase subunit a (atpB)

This Recombinant Janthinobacterium sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A6T476

Expression Region

1-273

Origin

Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDHAAPTASEYIVHHLGHFSTKHQDKIVDFSIINMDTIFWSIFAGVVGCLFMYLAARK ATSGVPGRFQAAVEMIVEMVDNQAKSIVHGDRTFIAPLALTVFVWVALMNSLDFLPVDMF SAFFHAVGLDSLITHHRVVPTADLNGTMGIALGVFALMIFYNIKIKGAGGFVHELFAAPF GIWLAPFNLLLNMIEFAAKTVSLAMRLFGNMYAGELLFLLIALLGSTATAFGFFGHVVAG TLWAIFHILIVFLQAFIFMMLTLVYIGQAHESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, PIGL ELISA Kit
MBS9319985-01 48 Well

Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, PIGL ELISA Kit

Sign In for Pricing
View Details
Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, PIGL ELISA Kit
MBS9319985-02 96 Well

Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, PIGL ELISA Kit

Sign In for Pricing
View Details
Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, PIGL ELISA Kit
MBS9319985-03 5x 96 Well

Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, PIGL ELISA Kit

Sign In for Pricing
View Details
Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, PIGL ELISA Kit
MBS9319985-04 10x 96 Well

Rat N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase, PIGL ELISA Kit

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica 3-ketodihydrosphingosine reductase TSC10 (TSC10)
orb2925662-01 20 µg

Recombinant Yarrowia lipolytica 3-ketodihydrosphingosine reductase TSC10 (TSC10)

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica 3-ketodihydrosphingosine reductase TSC10 (TSC10)
orb2925662-02 100 µg

Recombinant Yarrowia lipolytica 3-ketodihydrosphingosine reductase TSC10 (TSC10)

Sign In for Pricing
View Details