Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Odocoileus virginianus virginianus Medium-wave-sensitive opsin 1 (OPN1MW)

This Recombinant Odocoileus virginianus virginianus Medium-wave-sensitive opsin 1 (OPN1MW) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 1, Green cone photoreceptor pigment, Green-sensitive opsin

UniProt

O18911

Expression Region

1-273

Origin

Odocoileus virginianus virginianus (Virginia white-tailed deer)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APRWVYHLTSAWMVFVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAIADLVETIIAS TISVVNQMYGYFVLGHPLCVVEGYTASLCGITGLWSLAIISWERWMVVCRPFGNVRFDAK LAIAGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITC CFIPLSVIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAFCLCWGPYAFF ACFAAAHPGYAFHPLVAALPAYFAKSATIYNPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY3 Rabbit Polyclonal Antibody (AP)
orb966084 100 µL

ADCY3 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Gamma tubuLin complex component 3 (TUBGCP3) (NM_006322) Human Tagged ORF Clone
RC207395 10 µg

Gamma tubuLin complex component 3 (TUBGCP3) (NM_006322) Human Tagged ORF Clone

Sign In for Pricing
View Details
Dynlrb2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3534107 1.0 µg DNA

Dynlrb2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
ATG16L1 (NM_017974) Human Tagged Lenti ORF Clone
RC212340L1 10 µg

ATG16L1 (NM_017974) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Sting1 Knockout LL/2 (LLC1) Cell Line
ARG0499 1 Million

Sting1 Knockout LL/2 (LLC1) Cell Line

Sign In for Pricing
View Details
FOXP3 Rabbit Polyclonal Antibody (APC)
orb1004146 100 µL

FOXP3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details