Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Odocoileus virginianus virginianus Medium-wave-sensitive opsin 1 (OPN1MW)

This Recombinant Odocoileus virginianus virginianus Medium-wave-sensitive opsin 1 (OPN1MW) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 1, Green cone photoreceptor pigment, Green-sensitive opsin

UniProt

O18911

Expression Region

1-273

Origin

Odocoileus virginianus virginianus (Virginia white-tailed deer)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APRWVYHLTSAWMVFVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAIADLVETIIAS TISVVNQMYGYFVLGHPLCVVEGYTASLCGITGLWSLAIISWERWMVVCRPFGNVRFDAK LAIAGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMITC CFIPLSVIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVMVMIFAFCLCWGPYAFF ACFAAAHPGYAFHPLVAALPAYFAKSATIYNPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCARB1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2095507 1.0 µg DNA

SCARB1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
MMGT1 Mouse Monoclonal Antibody [Clone ID: OTI7B9]
TA811123 100 µL

MMGT1 Mouse Monoclonal Antibody [Clone ID: OTI7B9]

Sign In for Pricing
View Details
DCT (TRP2) Antibody
MBS8511934-01 0.05 mg

DCT (TRP2) Antibody

Sign In for Pricing
View Details
DCT (TRP2) Antibody
MBS8511934-02 0.1 mg

DCT (TRP2) Antibody

Sign In for Pricing
View Details
DCT (TRP2) Antibody
MBS8511934-03 0.1 mL (AF750)

DCT (TRP2) Antibody

Sign In for Pricing
View Details
DCT (TRP2) Antibody
MBS8511934-04 0.1 mL (AF405M)

DCT (TRP2) Antibody

Sign In for Pricing
View Details